Anti DDX24 pAb (ATL-HPA002554)

Atlas Antibodies

Catalog No.:
ATL-HPA002554-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 24
Gene Name: DDX24
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041645: 83%, ENSRNOG00000009166: 83%
Entrez Gene ID: 57062
Uniprot ID: Q9GZR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKE
Gene Sequence FPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKE
Gene ID - Mouse ENSMUSG00000041645
Gene ID - Rat ENSRNOG00000009166
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX24 pAb (ATL-HPA002554)
Datasheet Anti DDX24 pAb (ATL-HPA002554) Datasheet (External Link)
Vendor Page Anti DDX24 pAb (ATL-HPA002554) at Atlas Antibodies

Documents & Links for Anti DDX24 pAb (ATL-HPA002554)
Datasheet Anti DDX24 pAb (ATL-HPA002554) Datasheet (External Link)
Vendor Page Anti DDX24 pAb (ATL-HPA002554)
Citations for Anti DDX24 pAb (ATL-HPA002554) – 2 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162.  PubMed