Anti DDX23 pAb (ATL-HPA039037)

Atlas Antibodies

Catalog No.:
ATL-HPA039037-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 23
Gene Name: DDX23
Alternative Gene Name: prp28, PRPF28, SNRNP100, U5-100K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003360: 100%, ENSRNOG00000060154: 100%
Entrez Gene ID: 9416
Uniprot ID: Q9BUQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM
Gene Sequence REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM
Gene ID - Mouse ENSMUSG00000003360
Gene ID - Rat ENSRNOG00000060154
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX23 pAb (ATL-HPA039037)
Datasheet Anti DDX23 pAb (ATL-HPA039037) Datasheet (External Link)
Vendor Page Anti DDX23 pAb (ATL-HPA039037) at Atlas Antibodies

Documents & Links for Anti DDX23 pAb (ATL-HPA039037)
Datasheet Anti DDX23 pAb (ATL-HPA039037) Datasheet (External Link)
Vendor Page Anti DDX23 pAb (ATL-HPA039037)