Anti DDX21 pAb (ATL-HPA036593 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036593-25

• 
• 
• 

Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 21
Gene Name: DDX21
Alternative Gene Name: GURDB, RH-II/GU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020075: 72%, ENSRNOG00000048990: 82%
Entrez Gene ID: 9188
Uniprot ID: Q9NR30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
• Gene Sequence: DSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
• Gene ID - Mouse: ENSMUSG00000020075
• Gene ID - Rat: ENSRNOG00000048990
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DDX21 pAb (ATL-HPA036593 w/enhanced validation) – 1 Found

Tanaka, Atsushi; Wang, Julia Y; Shia, Jinru; Zhou, Yihua; Ogawa, Makiko; Hendrickson, Ronald C; Klimstra, David S; Roehrl, Michael H. DEAD-box RNA helicase protein DDX21 as a prognosis marker for early stage colorectal cancer with microsatellite instability. Scientific Reports. 2020;10(1):22085.