Anti DDX17 pAb (ATL-HPA063142)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063142-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DDX17
Alternative Gene Name: P72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055065: 96%, ENSRNOG00000051170: 96%
Entrez Gene ID: 10521
Uniprot ID: Q92841
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ |
Gene Sequence | GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ |
Gene ID - Mouse | ENSMUSG00000055065 |
Gene ID - Rat | ENSRNOG00000051170 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DDX17 pAb (ATL-HPA063142) | |
Datasheet | Anti DDX17 pAb (ATL-HPA063142) Datasheet (External Link) |
Vendor Page | Anti DDX17 pAb (ATL-HPA063142) at Atlas Antibodies |
Documents & Links for Anti DDX17 pAb (ATL-HPA063142) | |
Datasheet | Anti DDX17 pAb (ATL-HPA063142) Datasheet (External Link) |
Vendor Page | Anti DDX17 pAb (ATL-HPA063142) |