Anti DDX11 pAb (ATL-HPA065197)

Atlas Antibodies

Catalog No.: ATL-HPA065197-25

Protein Description: DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11
Gene Name: DDX11
Alternative Gene Name: CHL1, CHLR1, KRG2, WABS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035842: 64%, ENSRNOG00000023803: 31%
Entrez Gene ID: 1663
Uniprot ID: Q96FC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV
• Gene Sequence: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV
• Gene ID - Mouse: ENSMUSG00000035842
• Gene ID - Rat: ENSRNOG00000023803
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.