Anti DDX11 pAb (ATL-HPA065197)

Atlas Antibodies

SKU:
ATL-HPA065197-25
  • Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11
Gene Name: DDX11
Alternative Gene Name: CHL1, CHLR1, KRG2, WABS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035842: 64%, ENSRNOG00000023803: 31%
Entrez Gene ID: 1663
Uniprot ID: Q96FC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV
Gene Sequence KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLV
Gene ID - Mouse ENSMUSG00000035842
Gene ID - Rat ENSRNOG00000023803
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX11 pAb (ATL-HPA065197)
Datasheet Anti DDX11 pAb (ATL-HPA065197) Datasheet (External Link)
Vendor Page Anti DDX11 pAb (ATL-HPA065197) at Atlas Antibodies

Documents & Links for Anti DDX11 pAb (ATL-HPA065197)
Datasheet Anti DDX11 pAb (ATL-HPA065197) Datasheet (External Link)
Vendor Page Anti DDX11 pAb (ATL-HPA065197)