Anti DDX10 pAb (ATL-HPA004691)

Atlas Antibodies

SKU:
ATL-HPA004691-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 10
Gene Name: DDX10
Alternative Gene Name: HRH-J8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053289: 76%, ENSRNOG00000012500: 78%
Entrez Gene ID: 1662
Uniprot ID: Q13206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSLTNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQDNDTGNEE
Gene Sequence KVPVKEIKINPEKLIDVQKKLESILAQDQDLKERAQRCFVSYVRSVYLMKDKEVFDVSKLPIPEYALSLGLAVAPRVRFLQKMQKQPTKELVRSQADKVIEPRAPSLTNDEVEEFRAYFNEKMSILQKGGKRLEGTEHRQDNDTGNEE
Gene ID - Mouse ENSMUSG00000053289
Gene ID - Rat ENSRNOG00000012500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX10 pAb (ATL-HPA004691)
Datasheet Anti DDX10 pAb (ATL-HPA004691) Datasheet (External Link)
Vendor Page Anti DDX10 pAb (ATL-HPA004691) at Atlas Antibodies

Documents & Links for Anti DDX10 pAb (ATL-HPA004691)
Datasheet Anti DDX10 pAb (ATL-HPA004691) Datasheet (External Link)
Vendor Page Anti DDX10 pAb (ATL-HPA004691)