Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034502-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DDX1
Alternative Gene Name: DBP-RB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037149: 96%, ENSRNOG00000006652: 94%
Entrez Gene ID: 1653
Uniprot ID: Q92499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY |
Gene Sequence | NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY |
Gene ID - Mouse | ENSMUSG00000037149 |
Gene ID - Rat | ENSRNOG00000006652 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation) | |
Datasheet | Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation) | |
Datasheet | Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation) |
Citations for Anti DDX1 pAb (ATL-HPA034502 w/enhanced validation) – 1 Found |
Kamel, Wael; Noerenberg, Marko; Cerikan, Berati; Chen, Honglin; Järvelin, Aino I; Kammoun, Mohamed; Lee, Jeffrey Y; Shuai, Ni; Garcia-Moreno, Manuel; Andrejeva, Anna; Deery, Michael J; Johnson, Natasha; Neufeldt, Christopher J; Cortese, Mirko; Knight, Michael L; Lilley, Kathryn S; Martinez, Javier; Davis, Ilan; Bartenschlager, Ralf; Mohammed, Shabaz; Castello, Alfredo. Global analysis of protein-RNA interactions in SARS-CoV-2-infected cells reveals key regulators of infection. Molecular Cell. 2021;81(13):2851-2867.e7. PubMed |