Anti DDR2 pAb (ATL-HPA070112)

Atlas Antibodies

SKU:
ATL-HPA070112-25
  • Immunofluorescent staining of human cell line BJ shows localization to actin filaments.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: discoidin domain receptor tyrosine kinase 2
Gene Name: DDR2
Alternative Gene Name: NTRKR3, TKT, TYRO10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026674: 96%, ENSRNOG00000002881: 93%
Entrez Gene ID: 4921
Uniprot ID: Q16832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ
Gene Sequence FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ
Gene ID - Mouse ENSMUSG00000026674
Gene ID - Rat ENSRNOG00000002881
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDR2 pAb (ATL-HPA070112)
Datasheet Anti DDR2 pAb (ATL-HPA070112) Datasheet (External Link)
Vendor Page Anti DDR2 pAb (ATL-HPA070112) at Atlas Antibodies

Documents & Links for Anti DDR2 pAb (ATL-HPA070112)
Datasheet Anti DDR2 pAb (ATL-HPA070112) Datasheet (External Link)
Vendor Page Anti DDR2 pAb (ATL-HPA070112)