Anti DDOST pAb (ATL-HPA046841)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046841-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DDOST
Alternative Gene Name: KIAA0115, OST, OST48, WBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028757: 97%, ENSRNOG00000015079: 98%
Entrez Gene ID: 1650
Uniprot ID: P39656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQY |
Gene Sequence | NYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQY |
Gene ID - Mouse | ENSMUSG00000028757 |
Gene ID - Rat | ENSRNOG00000015079 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DDOST pAb (ATL-HPA046841) | |
Datasheet | Anti DDOST pAb (ATL-HPA046841) Datasheet (External Link) |
Vendor Page | Anti DDOST pAb (ATL-HPA046841) at Atlas Antibodies |
Documents & Links for Anti DDOST pAb (ATL-HPA046841) | |
Datasheet | Anti DDOST pAb (ATL-HPA046841) Datasheet (External Link) |
Vendor Page | Anti DDOST pAb (ATL-HPA046841) |