Anti DDIT3 pAb (ATL-HPA058416)

Atlas Antibodies

SKU:
ATL-HPA058416-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DNA-damage-inducible transcript 3
Gene Name: DDIT3
Alternative Gene Name: CHOP, CHOP10, GADD153
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025408: 84%, ENSRNOG00000006789: 88%
Entrez Gene ID: 1649
Uniprot ID: P35638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ
Gene Sequence AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ
Gene ID - Mouse ENSMUSG00000025408
Gene ID - Rat ENSRNOG00000006789
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDIT3 pAb (ATL-HPA058416)
Datasheet Anti DDIT3 pAb (ATL-HPA058416) Datasheet (External Link)
Vendor Page Anti DDIT3 pAb (ATL-HPA058416) at Atlas Antibodies

Documents & Links for Anti DDIT3 pAb (ATL-HPA058416)
Datasheet Anti DDIT3 pAb (ATL-HPA058416) Datasheet (External Link)
Vendor Page Anti DDIT3 pAb (ATL-HPA058416)