Anti DDIAS pAb (ATL-HPA038541)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038541-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DDIAS
Alternative Gene Name: C11orf82, FLJ25416, FLJ38838, noxin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030641: 47%, ENSRNOG00000022521: 50%
Entrez Gene ID: 220042
Uniprot ID: Q8IXT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GFTVIDYFHQLLQTFNFRKLQCDSQAPNNHLLALDHSNSDLSSIYTSDSTSDFFKSCSKDTFSKFWQPSLEFTCIVSQLTDNDDFSASEQSKAFGTLQQNRKS |
| Gene Sequence | GFTVIDYFHQLLQTFNFRKLQCDSQAPNNHLLALDHSNSDLSSIYTSDSTSDFFKSCSKDTFSKFWQPSLEFTCIVSQLTDNDDFSASEQSKAFGTLQQNRKS |
| Gene ID - Mouse | ENSMUSG00000030641 |
| Gene ID - Rat | ENSRNOG00000022521 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DDIAS pAb (ATL-HPA038541) | |
| Datasheet | Anti DDIAS pAb (ATL-HPA038541) Datasheet (External Link) |
| Vendor Page | Anti DDIAS pAb (ATL-HPA038541) at Atlas Antibodies |
| Documents & Links for Anti DDIAS pAb (ATL-HPA038541) | |
| Datasheet | Anti DDIAS pAb (ATL-HPA038541) Datasheet (External Link) |
| Vendor Page | Anti DDIAS pAb (ATL-HPA038541) |
| Citations for Anti DDIAS pAb (ATL-HPA038541) – 1 Found |
| Liu, Nan; Zhang, Xiupeng; Zhou, Haijing; Cai, Lin; Li, Ailin; Miao, Yuan; Li, Qingchang; Qiu, Xueshan; Wang, Enhua. DDIAS promotes invasion and proliferation of non-small cell lung cancer and predicts poor survival of lung cancer patients. International Journal Of Clinical And Experimental Pathology. 10(12):11506-11515. PubMed |