Anti DDIAS pAb (ATL-HPA038541)

Atlas Antibodies

SKU:
ATL-HPA038541-25
  • Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DNA damage-induced apoptosis suppressor
Gene Name: DDIAS
Alternative Gene Name: C11orf82, FLJ25416, FLJ38838, noxin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030641: 47%, ENSRNOG00000022521: 50%
Entrez Gene ID: 220042
Uniprot ID: Q8IXT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFTVIDYFHQLLQTFNFRKLQCDSQAPNNHLLALDHSNSDLSSIYTSDSTSDFFKSCSKDTFSKFWQPSLEFTCIVSQLTDNDDFSASEQSKAFGTLQQNRKS
Gene Sequence GFTVIDYFHQLLQTFNFRKLQCDSQAPNNHLLALDHSNSDLSSIYTSDSTSDFFKSCSKDTFSKFWQPSLEFTCIVSQLTDNDDFSASEQSKAFGTLQQNRKS
Gene ID - Mouse ENSMUSG00000030641
Gene ID - Rat ENSRNOG00000022521
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDIAS pAb (ATL-HPA038541)
Datasheet Anti DDIAS pAb (ATL-HPA038541) Datasheet (External Link)
Vendor Page Anti DDIAS pAb (ATL-HPA038541) at Atlas Antibodies

Documents & Links for Anti DDIAS pAb (ATL-HPA038541)
Datasheet Anti DDIAS pAb (ATL-HPA038541) Datasheet (External Link)
Vendor Page Anti DDIAS pAb (ATL-HPA038541)



Citations for Anti DDIAS pAb (ATL-HPA038541) – 1 Found
Liu, Nan; Zhang, Xiupeng; Zhou, Haijing; Cai, Lin; Li, Ailin; Miao, Yuan; Li, Qingchang; Qiu, Xueshan; Wang, Enhua. DDIAS promotes invasion and proliferation of non-small cell lung cancer and predicts poor survival of lung cancer patients. International Journal Of Clinical And Experimental Pathology. 10(12):11506-11515.  PubMed