Anti DDI2 pAb (ATL-HPA043225)

Atlas Antibodies

SKU: ATL-HPA043225-25

• 
• 

Protein Description: DNA-damage inducible 1 homolog 2 (S. cerevisiae)
Gene Name: DDI2
Alternative Gene Name: MGC14844
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078515: 100%, ENSRNOG00000012274: 100%
Entrez Gene ID: 84301
Uniprot ID: Q5TDH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGL
• Gene Sequence: VDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGL
• Gene ID - Mouse: ENSMUSG00000078515
• Gene ID - Rat: ENSRNOG00000012274
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.