Anti DDHD2 pAb (ATL-HPA023147)

Atlas Antibodies

SKU: ATL-HPA023147-25

• 
• 
• 

Protein Description: DDHD domain containing 2
Gene Name: DDHD2
Alternative Gene Name: KIAA0725, SAMWD1, SPG54
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061313: 87%, ENSRNOG00000015501: 88%
Entrez Gene ID: 23259
Uniprot ID: O94830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RMHLELREGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINVGMLNGGQRIDYVLQEK
• Gene Sequence: RMHLELREGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINVGMLNGGQRIDYVLQEK
• Gene ID - Mouse: ENSMUSG00000061313
• Gene ID - Rat: ENSRNOG00000015501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.