Anti DDB1 pAb (ATL-HPA068456)

Atlas Antibodies

Catalog No.:
ATL-HPA068456-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: damage-specific DNA binding protein 1, 127kDa
Gene Name: DDB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024740: 100%, ENSRNOG00000020715: 99%
Entrez Gene ID: 1642
Uniprot ID: Q16531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
Gene Sequence LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
Gene ID - Mouse ENSMUSG00000024740
Gene ID - Rat ENSRNOG00000020715
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDB1 pAb (ATL-HPA068456)
Datasheet Anti DDB1 pAb (ATL-HPA068456) Datasheet (External Link)
Vendor Page Anti DDB1 pAb (ATL-HPA068456) at Atlas Antibodies

Documents & Links for Anti DDB1 pAb (ATL-HPA068456)
Datasheet Anti DDB1 pAb (ATL-HPA068456) Datasheet (External Link)
Vendor Page Anti DDB1 pAb (ATL-HPA068456)