Anti DDB1 pAb (ATL-HPA045174)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045174-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DDB1
Alternative Gene Name: XPE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024740: 100%, ENSRNOG00000020715: 100%
Entrez Gene ID: 1642
Uniprot ID: Q16531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGD |
Gene Sequence | LEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGD |
Gene ID - Mouse | ENSMUSG00000024740 |
Gene ID - Rat | ENSRNOG00000020715 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DDB1 pAb (ATL-HPA045174) | |
Datasheet | Anti DDB1 pAb (ATL-HPA045174) Datasheet (External Link) |
Vendor Page | Anti DDB1 pAb (ATL-HPA045174) at Atlas Antibodies |
Documents & Links for Anti DDB1 pAb (ATL-HPA045174) | |
Datasheet | Anti DDB1 pAb (ATL-HPA045174) Datasheet (External Link) |
Vendor Page | Anti DDB1 pAb (ATL-HPA045174) |