Anti DDAH2 pAb (ATL-HPA012509)

Atlas Antibodies

SKU:
ATL-HPA012509-100
  • Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in human cell line EFO-21.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: dimethylarginine dimethylaminohydrolase 2
Gene Name: DDAH2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007039: 99%, ENSRNOG00000000842: 99%
Entrez Gene ID: 23564
Uniprot ID: O95865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEI
Gene Sequence ESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEI
Gene ID - Mouse ENSMUSG00000007039
Gene ID - Rat ENSRNOG00000000842
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDAH2 pAb (ATL-HPA012509)
Datasheet Anti DDAH2 pAb (ATL-HPA012509) Datasheet (External Link)
Vendor Page Anti DDAH2 pAb (ATL-HPA012509) at Atlas Antibodies

Documents & Links for Anti DDAH2 pAb (ATL-HPA012509)
Datasheet Anti DDAH2 pAb (ATL-HPA012509) Datasheet (External Link)
Vendor Page Anti DDAH2 pAb (ATL-HPA012509)