Anti DDAH1 pAb (ATL-HPA071064 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA071064-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dimethylarginine dimethylaminohydrolase 1
Gene Name: DDAH1
Alternative Gene Name: DDAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028194: 97%, ENSRNOG00000014613: 98%
Entrez Gene ID: 23576
Uniprot ID: O94760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKE
Gene Sequence ERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKE
Gene ID - Mouse ENSMUSG00000028194
Gene ID - Rat ENSRNOG00000014613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDAH1 pAb (ATL-HPA071064 w/enhanced validation)
Datasheet Anti DDAH1 pAb (ATL-HPA071064 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDAH1 pAb (ATL-HPA071064 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DDAH1 pAb (ATL-HPA071064 w/enhanced validation)
Datasheet Anti DDAH1 pAb (ATL-HPA071064 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDAH1 pAb (ATL-HPA071064 w/enhanced validation)