Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA006308-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dimethylarginine dimethylaminohydrolase 1
Gene Name: DDAH1
Alternative Gene Name: DDAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028194: 95%, ENSRNOG00000014613: 95%
Entrez Gene ID: 23576
Uniprot ID: O94760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLT
Gene Sequence SKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLT
Gene ID - Mouse ENSMUSG00000028194
Gene ID - Rat ENSRNOG00000014613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation)
Datasheet Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation)
Datasheet Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation)
Citations for Anti DDAH1 pAb (ATL-HPA006308 w/enhanced validation) – 2 Found
Shao, Zhili; Wang, Zeneng; Shrestha, Kevin; Thakur, Akanksha; Borowski, Allen G; Sweet, Wendy; Thomas, James D; Moravec, Christine S; Hazen, Stanley L; Tang, W H Wilson. Pulmonary hypertension associated with advanced systolic heart failure: dysregulated arginine metabolism and importance of compensatory dimethylarginine dimethylaminohydrolase-1. Journal Of The American College Of Cardiology. 2012;59(13):1150-8.  PubMed
Kozlova, Alena A; Ragavan, Vinitha N; Jarzebska, Natalia; Lukianova, Iana V; Bikmurzina, Anastasia E; Rubets, Elena; Suzuki-Yamamoto, Toshiko; Kimoto, Masumi; Mangoni, Arduino A; Gainetdinov, Raul R; Weiss, Norbert; Bauer, Michael; Markov, Alexander G; Rodionov, Roman N; Bernhardt, Nadine. Divergent Dimethylarginine Dimethylaminohydrolase Isoenzyme Expression in the Central Nervous System. Cellular And Molecular Neurobiology. 2022;42(7):2273-2288.  PubMed