Anti DCUN1D4 pAb (ATL-HPA036483)

Atlas Antibodies

Catalog No.:
ATL-HPA036483-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DCN1, defective in cullin neddylation 1, domain containing 4
Gene Name: DCUN1D4
Alternative Gene Name: KIAA0276
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051674: 96%, ENSRNOG00000002152: 98%
Entrez Gene ID: 23142
Uniprot ID: Q92564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCF
Gene Sequence VNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCF
Gene ID - Mouse ENSMUSG00000051674
Gene ID - Rat ENSRNOG00000002152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCUN1D4 pAb (ATL-HPA036483)
Datasheet Anti DCUN1D4 pAb (ATL-HPA036483) Datasheet (External Link)
Vendor Page Anti DCUN1D4 pAb (ATL-HPA036483) at Atlas Antibodies

Documents & Links for Anti DCUN1D4 pAb (ATL-HPA036483)
Datasheet Anti DCUN1D4 pAb (ATL-HPA036483) Datasheet (External Link)
Vendor Page Anti DCUN1D4 pAb (ATL-HPA036483)