Anti DCUN1D4 pAb (ATL-HPA036483)
Atlas Antibodies
- SKU:
- ATL-HPA036483-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DCUN1D4
Alternative Gene Name: KIAA0276
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051674: 96%, ENSRNOG00000002152: 98%
Entrez Gene ID: 23142
Uniprot ID: Q92564
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCF |
Gene Sequence | VNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCF |
Gene ID - Mouse | ENSMUSG00000051674 |
Gene ID - Rat | ENSRNOG00000002152 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DCUN1D4 pAb (ATL-HPA036483) | |
Datasheet | Anti DCUN1D4 pAb (ATL-HPA036483) Datasheet (External Link) |
Vendor Page | Anti DCUN1D4 pAb (ATL-HPA036483) at Atlas Antibodies |
Documents & Links for Anti DCUN1D4 pAb (ATL-HPA036483) | |
Datasheet | Anti DCUN1D4 pAb (ATL-HPA036483) Datasheet (External Link) |
Vendor Page | Anti DCUN1D4 pAb (ATL-HPA036483) |