Anti DCUN1D3 pAb (ATL-HPA043511)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043511-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DCUN1D3
Alternative Gene Name: DKFZp686O0290, FLJ41725, MGC48972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048787: 100%, ENSRNOG00000014037: 100%
Entrez Gene ID: 123879
Uniprot ID: Q8IWE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR |
| Gene Sequence | IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR |
| Gene ID - Mouse | ENSMUSG00000048787 |
| Gene ID - Rat | ENSRNOG00000014037 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCUN1D3 pAb (ATL-HPA043511) | |
| Datasheet | Anti DCUN1D3 pAb (ATL-HPA043511) Datasheet (External Link) |
| Vendor Page | Anti DCUN1D3 pAb (ATL-HPA043511) at Atlas Antibodies |
| Documents & Links for Anti DCUN1D3 pAb (ATL-HPA043511) | |
| Datasheet | Anti DCUN1D3 pAb (ATL-HPA043511) Datasheet (External Link) |
| Vendor Page | Anti DCUN1D3 pAb (ATL-HPA043511) |