Anti DCUN1D3 pAb (ATL-HPA043511)

Atlas Antibodies

Catalog No.:
ATL-HPA043511-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DCN1, defective in cullin neddylation 1, domain containing 3
Gene Name: DCUN1D3
Alternative Gene Name: DKFZp686O0290, FLJ41725, MGC48972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048787: 100%, ENSRNOG00000014037: 100%
Entrez Gene ID: 123879
Uniprot ID: Q8IWE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR
Gene Sequence IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR
Gene ID - Mouse ENSMUSG00000048787
Gene ID - Rat ENSRNOG00000014037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCUN1D3 pAb (ATL-HPA043511)
Datasheet Anti DCUN1D3 pAb (ATL-HPA043511) Datasheet (External Link)
Vendor Page Anti DCUN1D3 pAb (ATL-HPA043511) at Atlas Antibodies

Documents & Links for Anti DCUN1D3 pAb (ATL-HPA043511)
Datasheet Anti DCUN1D3 pAb (ATL-HPA043511) Datasheet (External Link)
Vendor Page Anti DCUN1D3 pAb (ATL-HPA043511)