Anti DCUN1D3 pAb (ATL-HPA043511)

Atlas Antibodies

Catalog No.: ATL-HPA043511-25

Protein Description: DCN1, defective in cullin neddylation 1, domain containing 3
Gene Name: DCUN1D3
Alternative Gene Name: DKFZp686O0290, FLJ41725, MGC48972
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048787: 100%, ENSRNOG00000014037: 100%
Entrez Gene ID: 123879
Uniprot ID: Q8IWE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR
• Gene Sequence: IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR
• Gene ID - Mouse: ENSMUSG00000048787
• Gene ID - Rat: ENSRNOG00000014037
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.