Anti DCUN1D2 pAb (ATL-HPA039349)

Atlas Antibodies

Catalog No.: ATL-HPA039349-25

Protein Description: DCN1, defective in cullin neddylation 1, domain containing 2
Gene Name: DCUN1D2
Alternative Gene Name: C13orf17, FLJ10704, FLJ20092
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038506: 81%, ENSRNOG00000019473: 80%
Entrez Gene ID: 55208
Uniprot ID: Q6PH85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
• Gene Sequence: QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
• Gene ID - Mouse: ENSMUSG00000038506
• Gene ID - Rat: ENSRNOG00000019473
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.