Anti DCUN1D2 pAb (ATL-HPA039349)

Atlas Antibodies

Catalog No.:
ATL-HPA039349-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DCN1, defective in cullin neddylation 1, domain containing 2
Gene Name: DCUN1D2
Alternative Gene Name: C13orf17, FLJ10704, FLJ20092
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038506: 81%, ENSRNOG00000019473: 80%
Entrez Gene ID: 55208
Uniprot ID: Q6PH85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
Gene Sequence QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
Gene ID - Mouse ENSMUSG00000038506
Gene ID - Rat ENSRNOG00000019473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCUN1D2 pAb (ATL-HPA039349)
Datasheet Anti DCUN1D2 pAb (ATL-HPA039349) Datasheet (External Link)
Vendor Page Anti DCUN1D2 pAb (ATL-HPA039349) at Atlas Antibodies

Documents & Links for Anti DCUN1D2 pAb (ATL-HPA039349)
Datasheet Anti DCUN1D2 pAb (ATL-HPA039349) Datasheet (External Link)
Vendor Page Anti DCUN1D2 pAb (ATL-HPA039349)