Anti DCUN1D2 pAb (ATL-HPA039349)
Atlas Antibodies
- SKU:
- ATL-HPA039349-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DCUN1D2
Alternative Gene Name: C13orf17, FLJ10704, FLJ20092
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038506: 81%, ENSRNOG00000019473: 80%
Entrez Gene ID: 55208
Uniprot ID: Q6PH85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY |
Gene Sequence | QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY |
Gene ID - Mouse | ENSMUSG00000038506 |
Gene ID - Rat | ENSRNOG00000019473 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DCUN1D2 pAb (ATL-HPA039349) | |
Datasheet | Anti DCUN1D2 pAb (ATL-HPA039349) Datasheet (External Link) |
Vendor Page | Anti DCUN1D2 pAb (ATL-HPA039349) at Atlas Antibodies |
Documents & Links for Anti DCUN1D2 pAb (ATL-HPA039349) | |
Datasheet | Anti DCUN1D2 pAb (ATL-HPA039349) Datasheet (External Link) |
Vendor Page | Anti DCUN1D2 pAb (ATL-HPA039349) |