Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035911-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DCN1, defective in cullin neddylation 1, domain containing 1
Gene Name: DCUN1D1
Alternative Gene Name: DCUN1L1, RP42, SCCRO, SCRO, Tes3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027708: 98%, ENSRNOG00000012734: 100%
Entrez Gene ID: 54165
Uniprot ID: Q96GG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
Gene Sequence RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
Gene ID - Mouse ENSMUSG00000027708
Gene ID - Rat ENSRNOG00000012734
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation)
Datasheet Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation)
Datasheet Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation)
Citations for Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation) – 1 Found
Chen, Ying; McGee, Jeremy; Chen, Xianming; Doman, Thompson N; Gong, Xueqian; Zhang, Youyan; Hamm, Nicole; Ma, Xiwen; Higgs, Richard E; Bhagwat, Shripad V; Buchanan, Sean; Peng, Sheng-Bin; Staschke, Kirk A; Yadav, Vipin; Yue, Yong; Kouros-Mehr, Hosein. Identification of druggable cancer driver genes amplified across TCGA datasets. Plos One. 9(5):e98293.  PubMed