Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035911-100

Protein Description: DCN1, defective in cullin neddylation 1, domain containing 1
Gene Name: DCUN1D1
Alternative Gene Name: DCUN1L1, RP42, SCCRO, SCRO, Tes3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027708: 98%, ENSRNOG00000012734: 100%
Entrez Gene ID: 54165
Uniprot ID: Q96GG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
• Gene Sequence: RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
• Gene ID - Mouse: ENSMUSG00000027708
• Gene ID - Rat: ENSRNOG00000012734
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DCUN1D1 pAb (ATL-HPA035911 w/enhanced validation) – 1 Found

Chen, Ying; McGee, Jeremy; Chen, Xianming; Doman, Thompson N; Gong, Xueqian; Zhang, Youyan; Hamm, Nicole; Ma, Xiwen; Higgs, Richard E; Bhagwat, Shripad V; Buchanan, Sean; Peng, Sheng-Bin; Staschke, Kirk A; Yadav, Vipin; Yue, Yong; Kouros-Mehr, Hosein. Identification of druggable cancer driver genes amplified across TCGA datasets. Plos One. 9(5):e98293.