Anti DCTPP1 pAb (ATL-HPA002832 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA002832-25
  • Immunohistochemical staining of human corpus, uterine shows strong cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DCTPP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411367).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dCTP pyrophosphatase 1
Gene Name: DCTPP1
Alternative Gene Name: CDA03, MGC5627, RS21C6, XTP3TPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042462: 80%, ENSRNOG00000017850: 78%
Entrez Gene ID: 79077
Uniprot ID: Q9H773
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDS
Gene Sequence RLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDS
Gene ID - Mouse ENSMUSG00000042462
Gene ID - Rat ENSRNOG00000017850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DCTPP1 pAb (ATL-HPA002832 w/enhanced validation)
Datasheet Anti DCTPP1 pAb (ATL-HPA002832 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCTPP1 pAb (ATL-HPA002832 w/enhanced validation)



Citations for Anti DCTPP1 pAb (ATL-HPA002832 w/enhanced validation) – 2 Found
Corson, Timothy W; Cavga, Hüseyin; Aberle, Nicholas; Crews, Craig M. Triptolide directly inhibits dCTP pyrophosphatase. Chembiochem : A European Journal Of Chemical Biology. 2011;12(11):1767-73.  PubMed
Morisaki, Tamami; Yashiro, Masakazu; Kakehashi, Anna; Inagaki, Azusa; Kinoshita, Haruhito; Fukuoka, Tatsunari; Kasashima, Hiroaki; Masuda, Go; Sakurai, Katsunobu; Kubo, Naoshi; Muguruma, Kazuya; Ohira, Masaichi; Wanibuchi, Hideki; Hirakawa, Kosei. Comparative proteomics analysis of gastric cancer stem cells. Plos One. 9(11):e110736.  PubMed