Anti DCTN6 pAb (ATL-HPA024558)

Atlas Antibodies

SKU:
ATL-HPA024558-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dynactin 6
Gene Name: DCTN6
Alternative Gene Name: WS-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031516: 95%, ENSRNOG00000013254: 96%
Entrez Gene ID: 10671
Uniprot ID: O00399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCY
Gene Sequence AEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCY
Gene ID - Mouse ENSMUSG00000031516
Gene ID - Rat ENSRNOG00000013254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCTN6 pAb (ATL-HPA024558)
Datasheet Anti DCTN6 pAb (ATL-HPA024558) Datasheet (External Link)
Vendor Page Anti DCTN6 pAb (ATL-HPA024558) at Atlas Antibodies

Documents & Links for Anti DCTN6 pAb (ATL-HPA024558)
Datasheet Anti DCTN6 pAb (ATL-HPA024558) Datasheet (External Link)
Vendor Page Anti DCTN6 pAb (ATL-HPA024558)