Anti DCTN6 pAb (ATL-HPA024558)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024558-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DCTN6
Alternative Gene Name: WS-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031516: 95%, ENSRNOG00000013254: 96%
Entrez Gene ID: 10671
Uniprot ID: O00399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCY |
Gene Sequence | AEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCY |
Gene ID - Mouse | ENSMUSG00000031516 |
Gene ID - Rat | ENSRNOG00000013254 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DCTN6 pAb (ATL-HPA024558) | |
Datasheet | Anti DCTN6 pAb (ATL-HPA024558) Datasheet (External Link) |
Vendor Page | Anti DCTN6 pAb (ATL-HPA024558) at Atlas Antibodies |
Documents & Links for Anti DCTN6 pAb (ATL-HPA024558) | |
Datasheet | Anti DCTN6 pAb (ATL-HPA024558) Datasheet (External Link) |
Vendor Page | Anti DCTN6 pAb (ATL-HPA024558) |