Anti DCTN5 pAb (ATL-HPA063710)

Atlas Antibodies

SKU:
ATL-HPA063710-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & nuclear membrane.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dynactin 5 (p25)
Gene Name: DCTN5
Alternative Gene Name: MGC3248, p25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030868: 100%, ENSRNOG00000018048: 100%
Entrez Gene ID: 84516
Uniprot ID: Q9BTE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF
Gene Sequence VFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKF
Gene ID - Mouse ENSMUSG00000030868
Gene ID - Rat ENSRNOG00000018048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCTN5 pAb (ATL-HPA063710)
Datasheet Anti DCTN5 pAb (ATL-HPA063710) Datasheet (External Link)
Vendor Page Anti DCTN5 pAb (ATL-HPA063710) at Atlas Antibodies

Documents & Links for Anti DCTN5 pAb (ATL-HPA063710)
Datasheet Anti DCTN5 pAb (ATL-HPA063710) Datasheet (External Link)
Vendor Page Anti DCTN5 pAb (ATL-HPA063710)