Anti DCTN5 pAb (ATL-HPA042003)

Atlas Antibodies

SKU:
ATL-HPA042003-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in human cell line K562.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dynactin 5 (p25)
Gene Name: DCTN5
Alternative Gene Name: MGC3248, p25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030868: 99%, ENSRNOG00000018048: 99%
Entrez Gene ID: 84516
Uniprot ID: Q9BTE1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGV
Gene Sequence LGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGV
Gene ID - Mouse ENSMUSG00000030868
Gene ID - Rat ENSRNOG00000018048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCTN5 pAb (ATL-HPA042003)
Datasheet Anti DCTN5 pAb (ATL-HPA042003) Datasheet (External Link)
Vendor Page Anti DCTN5 pAb (ATL-HPA042003) at Atlas Antibodies

Documents & Links for Anti DCTN5 pAb (ATL-HPA042003)
Datasheet Anti DCTN5 pAb (ATL-HPA042003) Datasheet (External Link)
Vendor Page Anti DCTN5 pAb (ATL-HPA042003)