Anti DCTN4 pAb (ATL-HPA038026)

Atlas Antibodies

SKU:
ATL-HPA038026-25
  • Immunohistochemical staining of human placenta shows cytoplasmic and membranous positivity in trophoblastic cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dynactin 4 (p62)
Gene Name: DCTN4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024603: 96%, ENSRNOG00000019298: 96%
Entrez Gene ID: 51164
Uniprot ID: Q9UJW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INSTAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPIEESDQGTE
Gene Sequence INSTAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPIEESDQGTE
Gene ID - Mouse ENSMUSG00000024603
Gene ID - Rat ENSRNOG00000019298
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCTN4 pAb (ATL-HPA038026)
Datasheet Anti DCTN4 pAb (ATL-HPA038026) Datasheet (External Link)
Vendor Page Anti DCTN4 pAb (ATL-HPA038026) at Atlas Antibodies

Documents & Links for Anti DCTN4 pAb (ATL-HPA038026)
Datasheet Anti DCTN4 pAb (ATL-HPA038026) Datasheet (External Link)
Vendor Page Anti DCTN4 pAb (ATL-HPA038026)