Anti DCTN3 pAb (ATL-HPA044905)

Atlas Antibodies

Catalog No.:
ATL-HPA044905-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: dynactin 3 (p22)
Gene Name: DCTN3
Alternative Gene Name: DCTN-22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028447: 95%, ENSRNOG00000014208: 97%
Entrez Gene ID: 11258
Uniprot ID: O75935
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPA
Gene Sequence FILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPA
Gene ID - Mouse ENSMUSG00000028447
Gene ID - Rat ENSRNOG00000014208
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCTN3 pAb (ATL-HPA044905)
Datasheet Anti DCTN3 pAb (ATL-HPA044905) Datasheet (External Link)
Vendor Page Anti DCTN3 pAb (ATL-HPA044905) at Atlas Antibodies

Documents & Links for Anti DCTN3 pAb (ATL-HPA044905)
Datasheet Anti DCTN3 pAb (ATL-HPA044905) Datasheet (External Link)
Vendor Page Anti DCTN3 pAb (ATL-HPA044905)