Anti DCTN2 pAb (ATL-HPA040040 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040040-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-DCTN2 antibody HPA040040 (A) shows similar protein distribution across tissues to independent antibody HPA039715 (B).
  • Western blot analysis using Anti-DCTN2 antibody HPA040040 (A) shows similar pattern to independent antibody HPA039715 (B).
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: dynactin 2 (p50)
Gene Name: DCTN2
Alternative Gene Name: DCTN-50, RBP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025410: 93%, ENSRNOG00000025481: 94%
Entrez Gene ID: 10540
Uniprot ID: Q13561
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Gene Sequence RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Gene ID - Mouse ENSMUSG00000025410
Gene ID - Rat ENSRNOG00000025481
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCTN2 pAb (ATL-HPA040040 w/enhanced validation)
Datasheet Anti DCTN2 pAb (ATL-HPA040040 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCTN2 pAb (ATL-HPA040040 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DCTN2 pAb (ATL-HPA040040 w/enhanced validation)
Datasheet Anti DCTN2 pAb (ATL-HPA040040 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCTN2 pAb (ATL-HPA040040 w/enhanced validation)