Anti DCTN1 pAb (ATL-HPA071875)

Atlas Antibodies

Catalog No.:
ATL-HPA071875-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: dynactin subunit 1
Gene Name: DCTN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031865: 95%, ENSRNOG00000010048: 95%
Entrez Gene ID: 1639
Uniprot ID: Q14203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV
Gene Sequence ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV
Gene ID - Mouse ENSMUSG00000031865
Gene ID - Rat ENSRNOG00000010048
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCTN1 pAb (ATL-HPA071875)
Datasheet Anti DCTN1 pAb (ATL-HPA071875) Datasheet (External Link)
Vendor Page Anti DCTN1 pAb (ATL-HPA071875) at Atlas Antibodies

Documents & Links for Anti DCTN1 pAb (ATL-HPA071875)
Datasheet Anti DCTN1 pAb (ATL-HPA071875) Datasheet (External Link)
Vendor Page Anti DCTN1 pAb (ATL-HPA071875)