Anti DCTD pAb (ATL-HPA035894)

Atlas Antibodies

SKU:
ATL-HPA035894-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dCMP deaminase
Gene Name: DCTD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031562: 90%, ENSRNOG00000013215: 90%
Entrez Gene ID: 1635
Uniprot ID: P32321
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHA
Gene Sequence QPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHA
Gene ID - Mouse ENSMUSG00000031562
Gene ID - Rat ENSRNOG00000013215
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCTD pAb (ATL-HPA035894)
Datasheet Anti DCTD pAb (ATL-HPA035894) Datasheet (External Link)
Vendor Page Anti DCTD pAb (ATL-HPA035894) at Atlas Antibodies

Documents & Links for Anti DCTD pAb (ATL-HPA035894)
Datasheet Anti DCTD pAb (ATL-HPA035894) Datasheet (External Link)
Vendor Page Anti DCTD pAb (ATL-HPA035894)