Anti DCT pAb (ATL-HPA010743 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA010743-25
  • Immunohistochemistry analysis in human skin and lymph node tissues using HPA010743 antibody. Corresponding DCT RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line SK-MEL-30 and human cell line U-2 OS.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: dopachrome tautomerase
Gene Name: DCT
Alternative Gene Name: TYRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022129: 88%, ENSRNOG00000016421: 46%
Entrez Gene ID: 1638
Uniprot ID: P40126
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDF
Gene Sequence WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDF
Gene ID - Mouse ENSMUSG00000022129
Gene ID - Rat ENSRNOG00000016421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCT pAb (ATL-HPA010743 w/enhanced validation)
Datasheet Anti DCT pAb (ATL-HPA010743 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCT pAb (ATL-HPA010743 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DCT pAb (ATL-HPA010743 w/enhanced validation)
Datasheet Anti DCT pAb (ATL-HPA010743 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DCT pAb (ATL-HPA010743 w/enhanced validation)