Anti DCST1 pAb (ATL-HPA060314)

Atlas Antibodies

Catalog No.:
ATL-HPA060314-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DC-STAMP domain containing 1
Gene Name: DCST1
Alternative Gene Name: FLJ32785
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042672: 57%, ENSRNOG00000020621: 63%
Entrez Gene ID: 149095
Uniprot ID: Q5T197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRHNLNNVIASLGCTVELQINNTRAAWRISTAPLRAMFKDLLSSKELLRAETRNISATFEDLDAQVNSETGYTPEDTMDSGETAQGR
Gene Sequence LRHNLNNVIASLGCTVELQINNTRAAWRISTAPLRAMFKDLLSSKELLRAETRNISATFEDLDAQVNSETGYTPEDTMDSGETAQGR
Gene ID - Mouse ENSMUSG00000042672
Gene ID - Rat ENSRNOG00000020621
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCST1 pAb (ATL-HPA060314)
Datasheet Anti DCST1 pAb (ATL-HPA060314) Datasheet (External Link)
Vendor Page Anti DCST1 pAb (ATL-HPA060314) at Atlas Antibodies

Documents & Links for Anti DCST1 pAb (ATL-HPA060314)
Datasheet Anti DCST1 pAb (ATL-HPA060314) Datasheet (External Link)
Vendor Page Anti DCST1 pAb (ATL-HPA060314)