Anti DCPS pAb (ATL-HPA039632 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039632-25

• 
• 
• 

Protein Description: decapping enzyme, scavenger
Gene Name: DCPS
Alternative Gene Name: HINT-5, HSL1, HSPC015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032040: 85%, ENSRNOG00000009993: 82%
Entrez Gene ID: 28960
Uniprot ID: Q96C86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPE
• Gene Sequence: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPE
• Gene ID - Mouse: ENSMUSG00000032040
• Gene ID - Rat: ENSRNOG00000009993
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DCPS pAb (ATL-HPA039632 w/enhanced validation) – 2 Found

Cherry, Jonathan J; DiDonato, Christine J; Androphy, Elliot J; Calo, Alessandro; Potter, Kyle; Custer, Sara K; Du, Sarah; Foley, Timothy L; Gopalsamy, Ariamala; Reedich, Emily J; Gordo, Susana M; Gordon, William; Hosea, Natalie; Jones, Lyn H; Krizay, Daniel K; LaRosa, Gregory; Li, Hongxia; Mathur, Sachin; Menard, Carol A; Patel, Paraj; Ramos-Zayas, Rebeca; Rietz, Anne; Rong, Haojing; Zhang, Baohong; Tones, Michael A. In vitro and in vivo effects of 2,4 diaminoquinazoline inhibitors of the decapping scavenger enzyme DcpS: Context-specific modulation of SMN transcript levels. Plos One. 12(9):e0185079. 

Ng, Calista K L; Shboul, Mohammad; Taverniti, Valerio; Bonnard, Carine; Lee, Hane; Eskin, Ascia; Nelson, Stanley F; Al-Raqad, Mohammed; Altawalbeh, Samah; Séraphin, Bertrand; Reversade, Bruno. Loss of the scavenger mRNA decapping enzyme DCPS causes syndromic intellectual disability with neuromuscular defects. Human Molecular Genetics. 2015;24(11):3163-71.