Anti DCP1B pAb (ATL-HPA058778)

Atlas Antibodies

Catalog No.:
ATL-HPA058778-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: decapping mRNA 1B
Gene Name: DCP1B
Alternative Gene Name: FLJ31638
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041477: 52%, ENSRNOG00000007340: 49%
Entrez Gene ID: 196513
Uniprot ID: Q8IZD4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRSLSYEEPRRHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNASRTQNL
Gene Sequence VRSLSYEEPRRHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNASRTQNL
Gene ID - Mouse ENSMUSG00000041477
Gene ID - Rat ENSRNOG00000007340
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCP1B pAb (ATL-HPA058778)
Datasheet Anti DCP1B pAb (ATL-HPA058778) Datasheet (External Link)
Vendor Page Anti DCP1B pAb (ATL-HPA058778) at Atlas Antibodies

Documents & Links for Anti DCP1B pAb (ATL-HPA058778)
Datasheet Anti DCP1B pAb (ATL-HPA058778) Datasheet (External Link)
Vendor Page Anti DCP1B pAb (ATL-HPA058778)