Anti DCP1A pAb (ATL-HPA013202)

Atlas Antibodies

SKU:
ATL-HPA013202-25
  • Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytoplasmic bodies.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: decapping mRNA 1A
Gene Name: DCP1A
Alternative Gene Name: HSA275986, SMAD4IP1, SMIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021962: 83%, ENSRNOG00000016015: 82%
Entrez Gene ID: 55802
Uniprot ID: Q9NPI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSASA
Gene Sequence RSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSASA
Gene ID - Mouse ENSMUSG00000021962
Gene ID - Rat ENSRNOG00000016015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCP1A pAb (ATL-HPA013202)
Datasheet Anti DCP1A pAb (ATL-HPA013202) Datasheet (External Link)
Vendor Page Anti DCP1A pAb (ATL-HPA013202) at Atlas Antibodies

Documents & Links for Anti DCP1A pAb (ATL-HPA013202)
Datasheet Anti DCP1A pAb (ATL-HPA013202) Datasheet (External Link)
Vendor Page Anti DCP1A pAb (ATL-HPA013202)



Citations for Anti DCP1A pAb (ATL-HPA013202) – 1 Found
Lindsay, Andrew J; McCaffrey, Mary W. Myosin Va is required for P body but not stress granule formation. The Journal Of Biological Chemistry. 2011;286(13):11519-28.  PubMed