Anti DCN pAb (ATL-HPA064736 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064736-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DCN
Alternative Gene Name: DSPG2, SLRR1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019929: 82%, ENSRNOG00000004554: 80%
Entrez Gene ID: 1634
Uniprot ID: P07585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY |
| Gene Sequence | VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY |
| Gene ID - Mouse | ENSMUSG00000019929 |
| Gene ID - Rat | ENSRNOG00000004554 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA064736 w/enhanced validation) |
| Citations for Anti DCN pAb (ATL-HPA064736 w/enhanced validation) – 1 Found |
| Hu, Xiaoding; Villodre, Emilly S; Larson, Richard; Rahal, Omar M; Wang, Xiaoping; Gong, Yun; Song, Juhee; Krishnamurthy, Savitri; Ueno, Naoto T; Tripathy, Debu; Woodward, Wendy A; Debeb, Bisrat G. Decorin-mediated suppression of tumorigenesis, invasion, and metastasis in inflammatory breast cancer. Communications Biology. 2021;4(1):72. PubMed |