Anti DCN pAb (ATL-HPA003315 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003315-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: DCN
Alternative Gene Name: DSPG2, SLRR1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019929: 78%, ENSRNOG00000004554: 76%
Entrez Gene ID: 1634
Uniprot ID: P07585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQY |
| Gene Sequence | TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQY |
| Gene ID - Mouse | ENSMUSG00000019929 |
| Gene ID - Rat | ENSRNOG00000004554 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCN pAb (ATL-HPA003315 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA003315 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA003315 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DCN pAb (ATL-HPA003315 w/enhanced validation) | |
| Datasheet | Anti DCN pAb (ATL-HPA003315 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DCN pAb (ATL-HPA003315 w/enhanced validation) |
| Citations for Anti DCN pAb (ATL-HPA003315 w/enhanced validation) – 5 Found |
| Cawthorn, Thomas R; Moreno, Juan C; Dharsee, Moyez; Tran-Thanh, Danh; Ackloo, Suzanne; Zhu, Pei Hong; Sardana, Girish; Chen, Jian; Kupchak, Peter; Jacks, Lindsay M; Miller, Naomi A; Youngson, Bruce J; Iakovlev, Vladimir; Guidos, Cynthia J; Vallis, Katherine A; Evans, Kenneth R; McCready, David; Leong, Wey L; Done, Susan J. Proteomic analyses reveal high expression of decorin and endoplasmin (HSP90B1) are associated with breast cancer metastasis and decreased survival. Plos One. 7(2):e30992. PubMed |
| Edlund, Karolina; Lindskog, Cecilia; Saito, Akira; Berglund, Anders; Pontén, Fredrik; Göransson-Kultima, Hanna; Isaksson, Anders; Jirström, Karin; Planck, Maria; Johansson, Leif; Lambe, Mats; Holmberg, Lars; Nyberg, Fredrik; Ekman, Simon; Bergqvist, Michael; Landelius, Per; Lamberg, Kristina; Botling, Johan; Ostman, Arne; Micke, Patrick. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. International Journal Of Cancer. 2012;131(10):2264-73. PubMed |
| Henke, Alexander; Grace, O Cathal; Ashley, George R; Stewart, Grant D; Riddick, Antony C P; Yeun, Henry; O'Donnell, Marie; Anderson, Richard A; Thomson, Axel A. Stromal expression of decorin, Semaphorin6D, SPARC, Sprouty1 and Tsukushi in developing prostate and decreased levels of decorin in prostate cancer. Plos One. 7(8):e42516. PubMed |
| Bozoky, Benedek; Savchenko, Andrii; Guven, Hayrettin; Ponten, Fredrik; Klein, George; Szekely, Laszlo. Decreased decorin expression in the tumor microenvironment. Cancer Medicine. 2014;3(3):485-91. PubMed |
| Reszegi, Andrea; Horváth, Zsolt; Karászi, Katalin; Regős, Eszter; Postniková, Victoria; Tátrai, Péter; Kiss, András; Schaff, Zsuzsa; Kovalszky, Ilona; Baghy, Kornélia. The Protective Role of Decorin in Hepatic Metastasis of Colorectal Carcinoma. Biomolecules. 2020;10(8) PubMed |