Anti DCLRE1A pAb (ATL-HPA036907)

Atlas Antibodies

Catalog No.:
ATL-HPA036907-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DNA cross-link repair 1A
Gene Name: DCLRE1A
Alternative Gene Name: hSNM1, KIAA0086, PSO2, SNM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025077: 76%, ENSRNOG00000026204: 74%
Entrez Gene ID: 9937
Uniprot ID: Q6PJP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Gene Sequence TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Gene ID - Mouse ENSMUSG00000025077
Gene ID - Rat ENSRNOG00000026204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCLRE1A pAb (ATL-HPA036907)
Datasheet Anti DCLRE1A pAb (ATL-HPA036907) Datasheet (External Link)
Vendor Page Anti DCLRE1A pAb (ATL-HPA036907) at Atlas Antibodies

Documents & Links for Anti DCLRE1A pAb (ATL-HPA036907)
Datasheet Anti DCLRE1A pAb (ATL-HPA036907) Datasheet (External Link)
Vendor Page Anti DCLRE1A pAb (ATL-HPA036907)