Anti DCLRE1A pAb (ATL-HPA036907)

Atlas Antibodies

SKU: ATL-HPA036907-25

• 
• 

Protein Description: DNA cross-link repair 1A
Gene Name: DCLRE1A
Alternative Gene Name: hSNM1, KIAA0086, PSO2, SNM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025077: 76%, ENSRNOG00000026204: 74%
Entrez Gene ID: 9937
Uniprot ID: Q6PJP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
• Gene Sequence: TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
• Gene ID - Mouse: ENSMUSG00000025077
• Gene ID - Rat: ENSRNOG00000026204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.