Anti DCK pAb (ATL-HPA062773)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062773-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DCK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029366: 93%, ENSRNOG00000003296: 91%
Entrez Gene ID: 1633
Uniprot ID: P27707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKD |
Gene Sequence | VNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKD |
Gene ID - Mouse | ENSMUSG00000029366 |
Gene ID - Rat | ENSRNOG00000003296 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DCK pAb (ATL-HPA062773) | |
Datasheet | Anti DCK pAb (ATL-HPA062773) Datasheet (External Link) |
Vendor Page | Anti DCK pAb (ATL-HPA062773) at Atlas Antibodies |
Documents & Links for Anti DCK pAb (ATL-HPA062773) | |
Datasheet | Anti DCK pAb (ATL-HPA062773) Datasheet (External Link) |
Vendor Page | Anti DCK pAb (ATL-HPA062773) |