Anti DCK pAb (ATL-HPA062773)

Atlas Antibodies

Catalog No.:
ATL-HPA062773-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: deoxycytidine kinase
Gene Name: DCK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029366: 93%, ENSRNOG00000003296: 91%
Entrez Gene ID: 1633
Uniprot ID: P27707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKD
Gene Sequence VNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKD
Gene ID - Mouse ENSMUSG00000029366
Gene ID - Rat ENSRNOG00000003296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCK pAb (ATL-HPA062773)
Datasheet Anti DCK pAb (ATL-HPA062773) Datasheet (External Link)
Vendor Page Anti DCK pAb (ATL-HPA062773) at Atlas Antibodies

Documents & Links for Anti DCK pAb (ATL-HPA062773)
Datasheet Anti DCK pAb (ATL-HPA062773) Datasheet (External Link)
Vendor Page Anti DCK pAb (ATL-HPA062773)