Anti DCDC2C pAb (ATL-HPA045848)

Atlas Antibodies

Catalog No.:
ATL-HPA045848-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: doublecortin domain containing 2C
Gene Name: DCDC2C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020633: 66%, ENSRNOG00000008299: 63%
Entrez Gene ID: 728597
Uniprot ID: A8MYV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLVQRGAEGDVYKAPTPSKETQGALDVKEEHNVQLEVPVDQ
Gene Sequence KEPCKYDGIPPKTQDSVYYAKEEKKKTLAEPLVQRGAEGDVYKAPTPSKETQGALDVKEEHNVQLEVPVDQ
Gene ID - Mouse ENSMUSG00000020633
Gene ID - Rat ENSRNOG00000008299
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCDC2C pAb (ATL-HPA045848)
Datasheet Anti DCDC2C pAb (ATL-HPA045848) Datasheet (External Link)
Vendor Page Anti DCDC2C pAb (ATL-HPA045848) at Atlas Antibodies

Documents & Links for Anti DCDC2C pAb (ATL-HPA045848)
Datasheet Anti DCDC2C pAb (ATL-HPA045848) Datasheet (External Link)
Vendor Page Anti DCDC2C pAb (ATL-HPA045848)