Anti DCDC2 pAb (ATL-HPA031584)

Atlas Antibodies

Catalog No.: ATL-HPA031584-25

Protein Description: doublecortin domain containing 2
Gene Name: DCDC2
Alternative Gene Name: DCDC2A, KIAA1154, NPHP19, RU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035910: 92%, ENSRNOG00000017511: 92%
Entrez Gene ID: 51473
Uniprot ID: Q9UHG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKASSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPL
• Gene Sequence: LEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKASSLPPIVGSRKSKGSGNDRHSKSTVGSSDNSSPQPL
• Gene ID - Mouse: ENSMUSG00000035910
• Gene ID - Rat: ENSRNOG00000017511
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.