Anti DCC pAb (ATL-HPA069552)

Atlas Antibodies

Catalog No.:
ATL-HPA069552-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: DCC netrin 1 receptor
Gene Name: DCC
Alternative Gene Name: IGDCC1, NTN1R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060534: 98%, ENSRNOG00000033099: 98%
Entrez Gene ID: 1630
Uniprot ID: P43146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS
Gene Sequence ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS
Gene ID - Mouse ENSMUSG00000060534
Gene ID - Rat ENSRNOG00000033099
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCC pAb (ATL-HPA069552)
Datasheet Anti DCC pAb (ATL-HPA069552) Datasheet (External Link)
Vendor Page Anti DCC pAb (ATL-HPA069552) at Atlas Antibodies

Documents & Links for Anti DCC pAb (ATL-HPA069552)
Datasheet Anti DCC pAb (ATL-HPA069552) Datasheet (External Link)
Vendor Page Anti DCC pAb (ATL-HPA069552)
Citations for Anti DCC pAb (ATL-HPA069552) – 1 Found
Patthey, Cedric; Tong, Yong Guang; Tait, Christine Mary; Wilson, Sara Ivy. Evolution of the functionally conserved DCC gene in birds. Scientific Reports. 2017;7( 28240293):42029.  PubMed