Anti DCC pAb (ATL-HPA069552)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069552-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: DCC
Alternative Gene Name: IGDCC1, NTN1R1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060534: 98%, ENSRNOG00000033099: 98%
Entrez Gene ID: 1630
Uniprot ID: P43146
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS |
| Gene Sequence | ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS |
| Gene ID - Mouse | ENSMUSG00000060534 |
| Gene ID - Rat | ENSRNOG00000033099 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCC pAb (ATL-HPA069552) | |
| Datasheet | Anti DCC pAb (ATL-HPA069552) Datasheet (External Link) |
| Vendor Page | Anti DCC pAb (ATL-HPA069552) at Atlas Antibodies |
| Documents & Links for Anti DCC pAb (ATL-HPA069552) | |
| Datasheet | Anti DCC pAb (ATL-HPA069552) Datasheet (External Link) |
| Vendor Page | Anti DCC pAb (ATL-HPA069552) |
| Citations for Anti DCC pAb (ATL-HPA069552) – 1 Found |
| Patthey, Cedric; Tong, Yong Guang; Tait, Christine Mary; Wilson, Sara Ivy. Evolution of the functionally conserved DCC gene in birds. Scientific Reports. 2017;7( 28240293):42029. PubMed |