Anti DCBLD2 pAb (ATL-HPA016909)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016909-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DCBLD2
Alternative Gene Name: CLCP1, ESDN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035107: 92%, ENSRNOG00000055281: 89%
Entrez Gene ID: 131566
Uniprot ID: Q96PD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST |
| Gene Sequence | AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST |
| Gene ID - Mouse | ENSMUSG00000035107 |
| Gene ID - Rat | ENSRNOG00000055281 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCBLD2 pAb (ATL-HPA016909) | |
| Datasheet | Anti DCBLD2 pAb (ATL-HPA016909) Datasheet (External Link) |
| Vendor Page | Anti DCBLD2 pAb (ATL-HPA016909) at Atlas Antibodies |
| Documents & Links for Anti DCBLD2 pAb (ATL-HPA016909) | |
| Datasheet | Anti DCBLD2 pAb (ATL-HPA016909) Datasheet (External Link) |
| Vendor Page | Anti DCBLD2 pAb (ATL-HPA016909) |
| Citations for Anti DCBLD2 pAb (ATL-HPA016909) – 2 Found |
| Raman, Pichai; Maddipati, Ravikanth; Lim, Kian Huat; Tozeren, Aydin. Pancreatic cancer survival analysis defines a signature that predicts outcome. Plos One. 13(8):e0201751. PubMed |
| Fukumoto, I; Kinoshita, T; Hanazawa, T; Kikkawa, N; Chiyomaru, T; Enokida, H; Yamamoto, N; Goto, Y; Nishikawa, R; Nakagawa, M; Okamoto, Y; Seki, N. Identification of tumour suppressive microRNA-451a in hypopharyngeal squamous cell carcinoma based on microRNA expression signature. British Journal Of Cancer. 2014;111(2):386-94. PubMed |