Anti DCBLD2 pAb (ATL-HPA016909)

Atlas Antibodies

SKU:
ATL-HPA016909-25
  • Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: discoidin, CUB and LCCL domain containing 2
Gene Name: DCBLD2
Alternative Gene Name: CLCP1, ESDN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035107: 92%, ENSRNOG00000055281: 89%
Entrez Gene ID: 131566
Uniprot ID: Q96PD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST
Gene Sequence AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST
Gene ID - Mouse ENSMUSG00000035107
Gene ID - Rat ENSRNOG00000055281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DCBLD2 pAb (ATL-HPA016909)
Datasheet Anti DCBLD2 pAb (ATL-HPA016909) Datasheet (External Link)
Vendor Page Anti DCBLD2 pAb (ATL-HPA016909) at Atlas Antibodies

Documents & Links for Anti DCBLD2 pAb (ATL-HPA016909)
Datasheet Anti DCBLD2 pAb (ATL-HPA016909) Datasheet (External Link)
Vendor Page Anti DCBLD2 pAb (ATL-HPA016909)



Citations for Anti DCBLD2 pAb (ATL-HPA016909) – 2 Found
Raman, Pichai; Maddipati, Ravikanth; Lim, Kian Huat; Tozeren, Aydin. Pancreatic cancer survival analysis defines a signature that predicts outcome. Plos One. 13(8):e0201751.  PubMed
Fukumoto, I; Kinoshita, T; Hanazawa, T; Kikkawa, N; Chiyomaru, T; Enokida, H; Yamamoto, N; Goto, Y; Nishikawa, R; Nakagawa, M; Okamoto, Y; Seki, N. Identification of tumour suppressive microRNA-451a in hypopharyngeal squamous cell carcinoma based on microRNA expression signature. British Journal Of Cancer. 2014;111(2):386-94.  PubMed