Anti DCBLD1 pAb (ATL-HPA059667)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059667-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DCBLD1
Alternative Gene Name: dJ94G16.1, MGC46341
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019891: 81%, ENSRNOG00000000407: 81%
Entrez Gene ID: 285761
Uniprot ID: Q8N8Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TFRPMDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGHKHSLSSGGF |
Gene Sequence | TFRPMDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGHKHSLSSGGF |
Gene ID - Mouse | ENSMUSG00000019891 |
Gene ID - Rat | ENSRNOG00000000407 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DCBLD1 pAb (ATL-HPA059667) | |
Datasheet | Anti DCBLD1 pAb (ATL-HPA059667) Datasheet (External Link) |
Vendor Page | Anti DCBLD1 pAb (ATL-HPA059667) at Atlas Antibodies |
Documents & Links for Anti DCBLD1 pAb (ATL-HPA059667) | |
Datasheet | Anti DCBLD1 pAb (ATL-HPA059667) Datasheet (External Link) |
Vendor Page | Anti DCBLD1 pAb (ATL-HPA059667) |