Anti DCBLD1 pAb (ATL-HPA059667)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059667-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DCBLD1
Alternative Gene Name: dJ94G16.1, MGC46341
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019891: 81%, ENSRNOG00000000407: 81%
Entrez Gene ID: 285761
Uniprot ID: Q8N8Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TFRPMDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGHKHSLSSGGF |
| Gene Sequence | TFRPMDTDAEEAGVSTDAGGHYDCPQRAGRHEYALPLAPPEPEYATPIVERHVLRAHTFSAQSGYRVPGPQPGHKHSLSSGGF |
| Gene ID - Mouse | ENSMUSG00000019891 |
| Gene ID - Rat | ENSRNOG00000000407 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCBLD1 pAb (ATL-HPA059667) | |
| Datasheet | Anti DCBLD1 pAb (ATL-HPA059667) Datasheet (External Link) |
| Vendor Page | Anti DCBLD1 pAb (ATL-HPA059667) at Atlas Antibodies |
| Documents & Links for Anti DCBLD1 pAb (ATL-HPA059667) | |
| Datasheet | Anti DCBLD1 pAb (ATL-HPA059667) Datasheet (External Link) |
| Vendor Page | Anti DCBLD1 pAb (ATL-HPA059667) |