Anti DCANP1 pAb (ATL-HPA048308)

Atlas Antibodies

Catalog No.:
ATL-HPA048308-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: dendritic cell-associated nuclear protein
Gene Name: DCANP1
Alternative Gene Name: C5orf20, DCNP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090891: 30%, ENSRNOG00000039656: 32%
Entrez Gene ID: 140947
Uniprot ID: Q8TF63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE
Gene Sequence KSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE
Gene ID - Mouse ENSMUSG00000090891
Gene ID - Rat ENSRNOG00000039656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCANP1 pAb (ATL-HPA048308)
Datasheet Anti DCANP1 pAb (ATL-HPA048308) Datasheet (External Link)
Vendor Page Anti DCANP1 pAb (ATL-HPA048308) at Atlas Antibodies

Documents & Links for Anti DCANP1 pAb (ATL-HPA048308)
Datasheet Anti DCANP1 pAb (ATL-HPA048308) Datasheet (External Link)
Vendor Page Anti DCANP1 pAb (ATL-HPA048308)