Anti DCANP1 pAb (ATL-HPA048308)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048308-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DCANP1
Alternative Gene Name: C5orf20, DCNP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090891: 30%, ENSRNOG00000039656: 32%
Entrez Gene ID: 140947
Uniprot ID: Q8TF63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE |
| Gene Sequence | KSLKSSDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAAHVPE |
| Gene ID - Mouse | ENSMUSG00000090891 |
| Gene ID - Rat | ENSRNOG00000039656 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCANP1 pAb (ATL-HPA048308) | |
| Datasheet | Anti DCANP1 pAb (ATL-HPA048308) Datasheet (External Link) |
| Vendor Page | Anti DCANP1 pAb (ATL-HPA048308) at Atlas Antibodies |
| Documents & Links for Anti DCANP1 pAb (ATL-HPA048308) | |
| Datasheet | Anti DCANP1 pAb (ATL-HPA048308) Datasheet (External Link) |
| Vendor Page | Anti DCANP1 pAb (ATL-HPA048308) |