Anti DCAKD pAb (ATL-HPA060997)

Atlas Antibodies

Catalog No.:
ATL-HPA060997-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: dephospho-CoA kinase domain containing
Gene Name: DCAKD
Alternative Gene Name: FLJ22955
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020935: 97%, ENSRNOG00000021682: 97%
Entrez Gene ID: 79877
Uniprot ID: Q8WVC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQLARLMR
Gene Sequence RRQLLNAITHPEIRKEMMKETFKYFLRGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQLARLMR
Gene ID - Mouse ENSMUSG00000020935
Gene ID - Rat ENSRNOG00000021682
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCAKD pAb (ATL-HPA060997)
Datasheet Anti DCAKD pAb (ATL-HPA060997) Datasheet (External Link)
Vendor Page Anti DCAKD pAb (ATL-HPA060997) at Atlas Antibodies

Documents & Links for Anti DCAKD pAb (ATL-HPA060997)
Datasheet Anti DCAKD pAb (ATL-HPA060997) Datasheet (External Link)
Vendor Page Anti DCAKD pAb (ATL-HPA060997)