Anti DCAF7 pAb (ATL-HPA022962 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022962-25

Protein Description: DDB1 and CUL4 associated factor 7
Gene Name: DCAF7
Alternative Gene Name: HAN11, SWAN-1, WDR68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049354: 100%, ENSRNOG00000042245: 100%
Entrez Gene ID: 10238
Uniprot ID: P61962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQ
• Gene Sequence: YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQ
• Gene ID - Mouse: ENSMUSG00000049354
• Gene ID - Rat: ENSRNOG00000042245
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DCAF7 pAb (ATL-HPA022962 w/enhanced validation) – 1 Found

Sircoulomb, Fabrice; Nicolas, Nathalie; Ferrari, Anthony; Finetti, Pascal; Bekhouche, Ismahane; Rousselet, Estelle; Lonigro, Aurélie; Adélaïde, José; Baudelet, Emilie; Esteyriès, Séverine; Wicinski, Julien; Audebert, Stéphane; Charafe-Jauffret, Emmanuelle; Jacquemier, Jocelyne; Lopez, Marc; Borg, Jean-Paul; Sotiriou, Christos; Popovici, Cornel; Bertucci, François; Birnbaum, Daniel; Chaffanet, Max; Ginestier, Christophe. ZNF703 gene amplification at 8p12 specifies luminal B breast cancer. Embo Molecular Medicine. 2011;3(3):153-66.