Anti DCAF7 pAb (ATL-HPA022948 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA022948-25

• 
• 
• 

Protein Description: DDB1 and CUL4 associated factor 7
Gene Name: DCAF7
Alternative Gene Name: HAN11, SWAN-1, WDR68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049354: 100%, ENSRNOG00000042245: 100%
Entrez Gene ID: 10238
Uniprot ID: P61962
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC
• Gene Sequence: PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC
• Gene ID - Mouse: ENSMUSG00000049354
• Gene ID - Rat: ENSRNOG00000042245
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DCAF7 pAb (ATL-HPA022948 w/enhanced validation) – 3 Found

Alvarado, Estibaliz; Yousefelahiyeh, Mina; Alvarado, Greg; Shang, Robin; Whitman, Taryn; Martinez, Andrew; Yu, Yang; Pham, Annie; Bhandari, Anish; Wang, Bingyan; Nissen, Robert M. Wdr68 Mediates Dorsal and Ventral Patterning Events for Craniofacial Development. Plos One. 11(11):e0166984. 

Yousefelahiyeh, Mina; Xu, Jingyi; Alvarado, Estibaliz; Yu, Yang; Salven, David; Nissen, Robert M. DCAF7/WDR68 is required for normal levels of DYRK1A and DYRK1B. Plos One. 13(11):e0207779. 

Frendo-Cumbo, Scott; Li, Taoyingnan; Ammendolia, Dustin A; Coyaud, Etienne; Laurent, Estelle M N; Liu, Yuan; Bilan, Philip J; Polevoy, Gordon; Raught, Brian; Brill, Julie A; Klip, Amira; Brumell, John H. DCAF7 regulates cell proliferation through IRS1-FOXO1 signaling. Iscience. 2022;25(10):105188.