Anti DCAF12L2 pAb (ATL-HPA053138)

Atlas Antibodies

Catalog No.:
ATL-HPA053138-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DDB1 and CUL4 associated factor 12-like 2
Gene Name: DCAF12L2
Alternative Gene Name: WDR40C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045284: 77%, ENSRNOG00000023458: 77%
Entrez Gene ID: 340578
Uniprot ID: Q5VW00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL
Gene Sequence SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL
Gene ID - Mouse ENSMUSG00000045284
Gene ID - Rat ENSRNOG00000023458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DCAF12L2 pAb (ATL-HPA053138)
Datasheet Anti DCAF12L2 pAb (ATL-HPA053138) Datasheet (External Link)
Vendor Page Anti DCAF12L2 pAb (ATL-HPA053138) at Atlas Antibodies

Documents & Links for Anti DCAF12L2 pAb (ATL-HPA053138)
Datasheet Anti DCAF12L2 pAb (ATL-HPA053138) Datasheet (External Link)
Vendor Page Anti DCAF12L2 pAb (ATL-HPA053138)