Anti DCAF12L2 pAb (ATL-HPA053138)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053138-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DCAF12L2
Alternative Gene Name: WDR40C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045284: 77%, ENSRNOG00000023458: 77%
Entrez Gene ID: 340578
Uniprot ID: Q5VW00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL |
| Gene Sequence | SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL |
| Gene ID - Mouse | ENSMUSG00000045284 |
| Gene ID - Rat | ENSRNOG00000023458 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DCAF12L2 pAb (ATL-HPA053138) | |
| Datasheet | Anti DCAF12L2 pAb (ATL-HPA053138) Datasheet (External Link) |
| Vendor Page | Anti DCAF12L2 pAb (ATL-HPA053138) at Atlas Antibodies |
| Documents & Links for Anti DCAF12L2 pAb (ATL-HPA053138) | |
| Datasheet | Anti DCAF12L2 pAb (ATL-HPA053138) Datasheet (External Link) |
| Vendor Page | Anti DCAF12L2 pAb (ATL-HPA053138) |